DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Tmprss4

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:250 Identity:85/250 - (34%)
Similarity:118/250 - (47%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHC----V 69
            |::|..|..|..:: ..|::||.....:..|||||||.:.:|:|||||.....|:|||||    :
  Rat   229 LVSLRCLDCGKSLK-TTRVVGGVEASADSWPWQVSIQYNKQHVCGGSILDHHWILTAAHCFRKYL 292

  Fly    70 QGQGYQVRAGSALKNSNGSVVDVAAIRTHE-----GLGNDIAIVRLSKPLEFTNQVQPI--PLAK 127
            ....::|||||. |..|...:.||.|...|     ....|||:|:|..||.|:..|:||  |.:.
  Rat   293 DVSSWKVRAGSN-KLGNSPSLPVAKIFIAEPNPLQPKEKDIALVKLKMPLTFSGSVRPICLPFSD 356

  Fly   128 TNPPPGSIAFVSGWGSSSYYS------------HPIDLQGVNLYIQWPYYCGLTEPSRICAGS-- 178
            ....|....:|.|||.:....            ..||....|..   ..|.|......:|||:  
  Rat   357 EELIPTMPVWVIGWGFTEENGGKMSDTLLQASVQVIDSARCNAE---DAYQGEVTAGMLCAGTPQ 418

  Fly   179 FGRAACKGDSGGPLVFDQ---QLVGVVSGGTKDCTYSS---IYTSVPYFREWILN 227
            .|:..|:|||||||::..   |:||:||.| ..|...|   :||.|..:.:||.|
  Rat   419 GGKDTCQGDSGGPLMYHYDKWQVVGIVSWG-YGCGSPSTPGVYTKVTAYLDWIYN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 78/229 (34%)
Tryp_SPc 27..225 CDD:238113 77/228 (34%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346 3/8 (38%)
Tryp_SPc 245..470 CDD:214473 78/229 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.