DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Ser8

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:255 Identity:102/255 - (40%)
Similarity:140/255 - (54%) Gaps:28/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLALNSLSAGPV-IRPEE-----RIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSA 59
            :.|.:||.||||.:.:..|: :.|:.     ||:||....||:.|||||:||.|.|.|||||.|.
  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISN 67

  Fly    60 DIIITAAHCVQG----QGYQVRAGSALKNSNGSVVDVAAIRTHEGLG-----NDIAIVRLSKPLE 115
            :||:|||||:..    ...::||||..:...|.:|:||||:.||...     |||.:|||...|.
  Fly    68 NIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLT 132

  Fly   116 FTNQVQPIPLAKTNPPPGSIAFVSGWGSSSYYS-HPIDLQGVNLYIQWPYYCG--------LTEP 171
            |.:.::.|.:|...|..||.|.:||||.:|... ....|..|:..|.....||        ..:.
  Fly   133 FGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKA 197

  Fly   172 SRICAGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREWILNA 228
            :.|||.:..:.||:||||||||...|||||||.| :||   .|..:|.::...|:|:|.|
  Fly   198 TMICAAATNKDACQGDSGGPLVSGGQLVGVVSWG-RDCAVANYPGVYANIAELRDWVLQA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 90/219 (41%)
Tryp_SPc 27..225 CDD:238113 89/218 (41%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 90/219 (41%)
Tryp_SPc 35..253 CDD:238113 89/218 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.