DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and thetaTry

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:256 Identity:93/256 - (36%)
Similarity:134/256 - (52%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALNSLSAGPV-------IRPEERIIGGQPIGIEEAPWQVSIQ-RDGKHLCGGSIYSADIII 63
            |:.||:.|..||.|       ...|.||:||:...|...|:|||:| :.|.|.||||:.:.|.::
  Fly     8 LVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVV 72

  Fly    64 TAAHCVQGQGYQ---VRAGSALKNSNGSVVDVAAIRTHEGLGN-----DIAIVRLSKPLEFTNQV 120
            |||||:.|:...   ||.||.|.|..|.||.|..:..:|...:     |:.|::|.:.::.|..:
  Fly    73 TAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENI 137

  Fly   121 QPIPLAKTNPPPGSIAFVSGWGSSSYY---SHPIDLQGVNL-YIQWP-------YYCGLTEPSRI 174
            :.|.||...||.|:.|.|:||||..|:   :.|..||.|.: .:.|.       .|..:...|.:
  Fly   138 RYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMV 202

  Fly   175 CAGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYS---SIYTSVPYFREWILNAIDEI 232
            ||....:.||:|||||||.....|||:||.|.. |..:   .:|:.||..|:|||||.:.:
  Fly   203 CAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYA-CASNLLPGVYSDVPALRKWILNASETL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 80/221 (36%)
Tryp_SPc 27..225 CDD:238113 79/220 (36%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 80/221 (36%)
Tryp_SPc 35..255 CDD:238113 79/220 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.