DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and KLK3

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:267 Identity:81/267 - (30%)
Similarity:127/267 - (47%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITA 65
            |::....|.|::..:.|.|:|.  .||:||........||||.:...|:.:|||.:.....::||
Human     1 MWVPVVFLTLSVTWIGAAPLIL--SRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTA 63

  Fly    66 AHCVQ------------------GQGYQVRAG--------SALKNSNGSVVDVAAIRTHEGLGND 104
            |||::                  ||.:||...        |.|||        ..:|..:...:|
Human    64 AHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKN--------RFLRPGDDSSHD 120

  Fly   105 IAIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGS--SSYYSHPIDLQGVNLYIQWPYYCG 167
            :.::|||:|.|.|:.|:.:.|....|..|:..:.|||||  ...:..|..||.|:|::.....|.
Human   121 LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCA 185

  Fly   168 LTEPSRI-----CAGSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDCTY---SSIYTSVPYFR 222
            ...|.::     |||.:  |::.|.||||||||.:..|.|:.|.|::.|..   .|:||.|.::|
Human   186 QVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYR 250

  Fly   223 EWILNAI 229
            :||.:.|
Human   251 KWIKDTI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 72/236 (31%)
Tryp_SPc 27..225 CDD:238113 71/235 (30%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.