DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Phae2

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:268 Identity:80/268 - (29%)
Similarity:117/268 - (43%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQSFLLLLALNSLSAGPVI-RPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAA 66
            :.:.|||....|..:|..: :||.|::||:......||:.||:|..|.|.|..:|.:::.::|||
  Fly     7 LATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAA 71

  Fly    67 HCV----QGQGYQVRAGSALKNSNGSVVDVAAIRTHEGLGN---------DIAIVRLSKPLEFTN 118
            ||:    |..|..:.|||.......|......| ||..:.:         ||.::.......:|.
  Fly    72 HCLANRNQVLGSTLVAGSIAVAGTASTTQKRQI-THYVINDLYTGGTVPYDIGLIYTPTAFTWTA 135

  Fly   119 QVQPIPLAKTNPPPGSIAFVSGWGSSSYY---SHPIDLQ-GVNLYIQWPYYCGLTEPSR------ 173
            .|.|:.|..:...|...|.:.||||:|..   |:|..|| ..|:.|.....|.....|:      
  Fly   136 AVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHT 200

  Fly   174 --ICAGSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREWILNAIDE 231
              :|.|..  |.:.|..|||||||....|:|:||.|...|   ...|:|..|..|..||      
  Fly   201 TNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI------ 259

  Fly   232 IMSANRNK 239
              :||:.|
  Fly   260 --AANQKK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 68/228 (30%)
Tryp_SPc 27..225 CDD:238113 67/227 (30%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 68/228 (30%)
Tryp_SPc 32..262 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.