DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and PRSS53

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:255 Identity:60/255 - (23%)
Similarity:95/255 - (37%) Gaps:91/255 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQG------QGYQV 76
            ||. :|:|   |....|  |.|||.|::|.|.|:|.||:.:...::|||||.:.      ..:.|
Human    34 GPP-KPQE---GNTVPG--EWPWQASVRRQGAHICSGSLVADTWVLTAAHCFEKAAATELNSWSV 92

  Fly    77 RAGSALK---NSNGSVVDVAAIR-----THEGLGNDIAIVRLSKPLEFTNQVQPIPLAKTNP--- 130
            ..||..:   :.....|.|||::     .|...|:|:|:::|:.|...|      ||....|   
Human    93 VLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQGSDLALLQLAHPTTHT------PLCLPQPAHR 151

  Fly   131 -PPGSIAFVSGWG----------------------------------------------SSSYYS 148
             |.|:..:.:||.                                              :.|...
Human   152 FPFGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSP 216

  Fly   149 HPIDLQGVNLYIQWPYYCG----------LTEPSR---ICAGSFG--RAACKGDSGGPLV 193
            .|..|:.:.|.:.....|.          |:.|:|   :|.|...  :..|:||||||::
Human   217 APGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 56/247 (23%)
Tryp_SPc 27..225 CDD:238113 56/246 (23%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 55/243 (23%)
Tryp_SPc 43..314 CDD:214473 55/242 (23%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.