DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG4271

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:213 Identity:67/213 - (31%)
Similarity:104/213 - (48%) Gaps:21/213 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SIQRDGKHLCGGSIYSADIIITAAHCVQGQGYQ---VRAGSALKNSNGSVVDVAAIRTHEGL--- 101
            |:...|.|.|||::..:.|::|||.||:.:..:   ||.|:......|.::.|.|:..||..   
  Fly    35 SVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENYKNW 99

  Fly   102 GNDIAIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSSYYSHPI--DLQGVNLYIQWPY 164
            .||||::.|.||: .:.:|..||||...|........:|||.....|:.:  .||.....|:...
  Fly   100 DNDIALLWLEKPV-LSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRS 163

  Fly   165 YCG--LTEP---SRICAGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYS---SIYTSVPYF 221
            .|.  |.||   ..:||.......|.||.|||||...::||:...| ..|.::   |:||:|.::
  Fly   164 MCAEELVEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQG-HGCGFAVLPSLYTNVFHY 227

  Fly   222 REWILNAIDEIMSANRNK 239
            .|||....::::   :||
  Fly   228 LEWIEENAEKLI---KNK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 63/197 (32%)
Tryp_SPc 27..225 CDD:238113 63/197 (32%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 65/200 (33%)
Tryp_SPc 19..231 CDD:214473 63/197 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.