DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Ser6

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:250 Identity:88/250 - (35%)
Similarity:117/250 - (46%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCV 69
            ||||.|.|...||...:  ..|::||:.....:.|.|||::..|.|.|||||.:...|:||||||
  Fly    12 SFLLFLVLPVQSAPGKL--NGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCV 74

  Fly    70 QGQG------------YQVRAGSALKNSNGSVVDVAAIRTHEGLG---NDIAIVRLSKPLEFTNQ 119
            ..:.            :.:||||..:.|.|.:|.||.:..||..|   ||:|::||..||..:..
  Fly    75 SNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSAS 139

  Fly   120 VQPIPLAKTNPPPGSIAFVSGWGSSSYYSHPIDLQGVNLYIQWPYYCGLTEPSRICAGSFG---- 180
            :|||.|...:.|......:||||.   ..|..||.   .|:|:.....:|.........||    
  Fly   140 IQPIDLPTVDTPADVDVVISGWGR---IKHQGDLP---RYLQYNTLKSITRQQCEELIDFGFEGE 198

  Fly   181 --------RAACKGDSGGPLVFDQQLVGVVSGGTKDC--TYSSIYTSVPYFREWI 225
                    ..||.||||||.|::.|||||.......|  ||...|..|.||::||
  Fly   199 LCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 78/227 (34%)
Tryp_SPc 27..225 CDD:238113 77/226 (34%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 78/227 (34%)
Tryp_SPc 32..256 CDD:238113 78/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.