DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Prss53

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:245 Identity:64/245 - (26%)
Similarity:106/245 - (43%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALNSL-SAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQG-- 71
            :|..|| ||||           |...:.:.||...::..||..|||::.|..:::|||||..|  
Mouse   294 VACGSLRSAGP-----------QAGALSQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFIGRQ 347

  Fly    72 --QGYQVRAGSALKNSNGSVVDVAAIRTHEGLGNDIAIVRLSKPLEFTNQVQP--IPLAKTNPPP 132
              :.:.|..|:..:......:.:....||...|.|:|.:.|::|:.....::|  :|.|..:.|.
Mouse   348 TLEEWSVGLGAGPEEWGLKQLILHGAYTHPEGGYDVAFLLLAQPVTLGPGLRPLCLPYADHHLPD 412

  Fly   133 GSIAFVSGWGSSSYYSHPIDLQGVNLYIQWPYYCGLTE-----------PSRICAGSFGRAA-CK 185
            |...:|.|....:..::|   |.|.:.:..|..|....           |..:|....|... |:
Mouse   413 GEHGWVLGLTQKAGINYP---QTVPVTVLGPMACSRQHAAPGGTGIPILPGMVCTTVVGEPPHCE 474

  Fly   186 GDSGGPLVFDQQ----LVGVVSGGTKDCTYSS----IYTSVPYFREWILN 227
            |.||.|||.:.:    |||:.|.|  |...||    ::.::..:.:||.|
Mouse   475 GLSGAPLVHEIRGTWFLVGLHSFG--DTCQSSAKPAVFAALSAYEDWISN 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 54/224 (24%)
Tryp_SPc 27..225 CDD:238113 54/223 (24%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113
Tryp_SPc 311..522 CDD:238113 55/215 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.