DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG4653

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:261 Identity:80/261 - (30%)
Similarity:113/261 - (43%) Gaps:53/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQSF-----LLLLALNSLSAGPVIR-PEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADI 61
            :||:     |||:.:.:|......| |.|  :|.|       |..:|::|:|.|:|||::.....
  Fly     4 VQSYSHSRLLLLVVIVTLGVVQSSRLPAE--VGSQ-------PHSISLRRNGVHVCGGALIREKW 59

  Fly    62 IITAAHCVQ---GQ------GYQVRAGSALKNSNGSVVDVAAIRTH------EGLG-NDIAIVRL 110
            |:||||||.   ||      .|.||.||..:.:.|.:|.::.|..|      :.:| ||:|::.|
  Fly    60 ILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLEL 124

  Fly   111 SKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSSY---YSHPI-----------DLQGVNLYIQ 161
            ...:.......||.||...|..||....||||||..   .||.:           |.| ..||:|
  Fly   125 ETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQ-TELYLQ 188

  Fly   162 WPYYCGLTEPSRICAGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDC--TYSSIYTSVPYFREW 224
            ......|:......||     .|.||:|.|..::.||||:.:.....|  .....|..|....||
  Fly   189 QEDLLCLSPVDEDFAG-----LCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEW 248

  Fly   225 I 225
            |
  Fly   249 I 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 69/230 (30%)
Tryp_SPc 27..225 CDD:238113 69/229 (30%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/235 (31%)
Tryp_SPc 30..249 CDD:214473 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.