DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG9673

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:253 Identity:74/253 - (29%)
Similarity:124/253 - (49%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALNSLSAGPVI----RPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHC 68
            :.|.|..|..|.::    .|:.||:||:.:...|.||..|::.:..|:|.|:|.|.:.|:|||||
  Fly     6 ITLGLGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHC 70

  Fly    69 VQGQG--------YQVRAGSALKNSNGSVVDVAAIRTHEGLGN---DIAIVRLSKPLEFTNQVQP 122
            |...|        ..||.|:..:.:.||:|:|.::..|...||   ||||:.|.:.|.|::::|.
  Fly    71 VSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFLHDIAILELDETLVFSDRIQD 135

  Fly   123 IPLAKTNP----------PPGSIAFVSGW-----GSSSYYSHPIDLQGVNLYI-QWPYYCGLTEP 171
            |.|..|..          |.|:..:|:||     |::||.....:...::..: :|.  .|....
  Fly   136 IALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCEWE--AGYGYE 198

  Fly   172 SRIC-AGSFGRAACKGDSGGPLVFDQQLV-GVVSGGTKDC--TYSSIYTSVPYFREWI 225
            |.:| :.:.|...|:||:|..::.|.::: |:.|.....|  .|..:.|.|.|:..||
  Fly   199 SVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 67/229 (29%)
Tryp_SPc 27..225 CDD:238113 66/228 (29%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 67/229 (29%)
Tryp_SPc 29..259 CDD:238113 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.