DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG33159

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:254 Identity:82/254 - (32%)
Similarity:127/254 - (50%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQG- 71
            |.|.|.|.|:      :.||:||:...|.|.|:.|.::::|..:||||:.|:..:::|||||.| 
  Fly    13 LALVLPSSSS------KTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGS 71

  Fly    72 --QGYQVRAGSALKNSNGSVV-DVAAIRTH-----EGLGNDIAIVRLSKPLEFT-NQVQPIPLAK 127
              :|:.|.||::..:....|| :|....|.     .....|:|:::|.:.:..| .:|..|...:
  Fly    72 QPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCR 136

  Fly   128 TNPPPG-SIAFVSGWG-SSSYYSHPID---------LQGVNLYIQWPYYCGLTEPSRICAGSFG- 180
             |||.| :.|.:|||| :......|.:         |.|....|.:..| |....|.:||...| 
  Fly   137 -NPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGY-GQLSDSMLCAAVRGL 199

  Fly   181 RAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFR--EWILNAIDEIMS 234
            |.:|.||||||||:..|:.|:||.|. .|   ::..:||:|...|  |:|...:..|.|
  Fly   200 RDSCSGDSGGPLVYRGQVCGIVSWGF-GCARPSFPGVYTNVASERVHEFIEQTLRRIGS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 74/225 (33%)
Tryp_SPc 27..225 CDD:238113 73/224 (33%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 72/218 (33%)
Tryp_SPc 26..251 CDD:238113 74/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.