DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG31267

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:117/265 - (44%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALNSLSAGPVIRP-------------EERIIGGQPIGIEEAPWQVSIQRD-GKHLCGGSIY 57
            |:|||| |.|...:.|.             ..||:||:...:..||:.||:|.. |.|.|.|||.
  Fly    13 LVLLAL-SFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSII 76

  Fly    58 SADIIITAAHCVQG-QGYQVRAGSALKN---SNGSVVDVAAIRTHEGLG-----NDIAIVRLSKP 113
            ....:||||.|:.| :...|:..:...|   |.|.:..|..|..|....     ||||:::....
  Fly    77 HDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHAL 141

  Fly   114 LEFTNQVQPIPLAKTNP-PPGSIAFVSGWGSS------SYYSHPIDLQGVNLYIQWPYYCGLT-- 169
            .::.:..|.|.:|.... ..|....:.|:||:      |:....:|:    .|:. |..|..|  
  Fly   142 FDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDV----TYVA-PEKCNATYG 201

  Fly   170 -----EPSRICA-GSFGRAACKGDSGGPLVFDQ-QLVGVVSGGTKDCTYS--SIYTSVPYFREWI 225
                 :...:|| |..|..||.||:|||:|..: :||||.:.|. .|.|.  .::..:.::..||
  Fly   202 GTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGV-PCGYGFPDVFARISFYYSWI 265

  Fly   226 LNAID 230
            ::.|:
  Fly   266 ISTIN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 64/226 (28%)
Tryp_SPc 27..225 CDD:238113 63/225 (28%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 64/226 (28%)
Tryp_SPc 45..268 CDD:238113 65/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.