DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG32808

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:265 Identity:84/265 - (31%)
Similarity:131/265 - (49%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLAL----NSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQR--DGKHLCGGSIYSA 59
            |.:.::|..|||    ..|.|| ....:.:|:.|...|..|.|:.||::|  .|:|.||.::.:.
  Fly     1 MAVMAWLARLALFYTATFLLAG-ASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNP 64

  Fly    60 DIIITAAHCVQG---QGYQVRAGSALKNSNGS-VVDVAAIRTHEGLG------NDIAIVRLSKPL 114
            ..::||||||:|   :...::.||.:...|.| |..||||..|.|..      ||||:::|::.:
  Fly    65 YWVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSV 129

  Fly   115 EFTNQVQPI--PLAKTNPPPGSIAFVSGWGSSS----YYSHPIDLQGVNLYIQWPYYCG-----L 168
            ..:..|||:  |..:...|..:.|.::|||.::    ...|   ||.|.|.:.....|.     .
  Fly   130 ALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQH---LQKVKLQVFSDTECSERHQTY 191

  Fly   169 TEPSRICAG--SFGRAACKGDSGGPLVF---DQQLVGVVSGGTKDCT---YSSIYTSVPYFREWI 225
            ...|:||||  ..|:..|.|||||||:.   |.| ||:||...|.|.   :..::|.|..:.:||
  Fly   192 LHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQ-VGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255

  Fly   226 LNAID 230
            :..::
  Fly   256 VETVN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 74/229 (32%)
Tryp_SPc 27..225 CDD:238113 74/228 (32%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/229 (32%)
Tryp_SPc 30..258 CDD:238113 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.