DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk8

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:247 Identity:73/247 - (29%)
Similarity:115/247 - (46%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAH 67
            ||:::||..|....||.......:|:.||.......|||.::.:..:.:|||.:.....::||||
  Rat     9 IQTWILLFLLMGAWAGLTRAQGSKILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTAAH 73

  Fly    68 CVQGQGYQVRAGS-ALKNSNGSVVDVAAIRT--H--------EGLGNDIAIVRLSKPLEFTNQVQ 121
            |.:.: |.||.|. :|:..:....::...|:  |        |...:||.::||.......::|:
  Rat    74 CKKDK-YSVRLGDHSLQKRDEPEQEIQVARSIQHPCFNSSNPEDHSHDIMLIRLQNSANLGDKVK 137

  Fly   122 PIPLAKTNPPPGSIAFVSGWGS----SSYYSHPIDLQGVNLYIQWPYYCGLTEPSRI-----CAG 177
            ||.||...|..|....:||||:    ...:.:.::...|.:|.|  ..|....|.:|     |||
  Rat   138 PIELANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQ--NKCERAYPGKITEGMVCAG 200

  Fly   178 SF-GRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREWI 225
            |. |...|:||||||||.:..|.|:.|.|:..|   ....:||.:..:..||
  Rat   201 SSNGADTCQGDSGGPLVCNGVLQGITSWGSDPCGKPEKPGVYTKICRYTNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 64/222 (29%)
Tryp_SPc 27..225 CDD:238113 64/221 (29%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 64/222 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.