DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk14

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:258 Identity:81/258 - (31%)
Similarity:127/258 - (49%) Gaps:39/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIQSF-------LLLLALNSLSAGPV-IRPEERIIGGQPIGIEEAPWQVSIQR--DGKHLCGGSI 56
            |:|::       |||..|.:|:...| .:.:::|:||........||||::|.  ..:.||||.:
  Rat    51 FLQTWTSGSRMLLLLTILQALAVAIVQSQGDDKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVL 115

  Fly    57 YSADIIITAAHCVQ-------GQGYQVRAGSALKNSNGSVVDVAAIRTH-----EGLGNDIAIVR 109
            .|...:||||||.:       |: :.:|...|.:    .|:.|.....|     :...||:.:::
  Rat   116 LSDQWVITAAHCARPLLHVALGK-HNLRRWEATQ----QVLRVVRQVPHPQYRPQAHDNDLMLLK 175

  Fly   110 LSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWG--SSSYYSHPIDLQGVNLYIQWPYYC-----G 167
            |.:.:.....|:.||:|::...||:...|||||  :|....:|..||.||:.|.....|     |
  Rat   176 LQRKVRLGRAVRTIPVARSCASPGTPCRVSGWGTTASPIVRYPTALQCVNVNIMPEQVCHRAYPG 240

  Fly   168 LTEPSRICAG--SFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCT---YSSIYTSVPYFREWI 225
            ......:|||  ..|:.:|:||||||||...||.|:||.|.:.|.   |..:||::..:..||
  Rat   241 TITSGMVCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCNYHSWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 71/224 (32%)
Tryp_SPc 27..225 CDD:238113 71/223 (32%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 73/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.