DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and GZMH

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:250 Identity:78/250 - (31%)
Similarity:111/250 - (44%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQSFLLLLA-LNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSI---QRDGKHLCGGSIYSADIII 63
            :|.|||||| |.:..||     .|.||||........|:...:   |...:..|||.:...|.::
Human     1 MQPFLLLLAFLLTPGAG-----TEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVL 60

  Fly    64 TAAHCVQGQGYQVRAGS-ALKNSNGSVVDVAAIR-------THEGLGNDIAIVRLSKPLEFTNQV 120
            ||||| ||....|..|: .:|....:...:...|       ..:...|||.:::|.:..::|..|
Human    61 TAAHC-QGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAV 124

  Fly   121 QP--IPLAKTNPPPGSIAFVSGWGSSSYYSHPIDLQGVNLYIQWPYYCGLTEPSRICAGSFGRAA 183
            :|  :|.:|....||.:..|:|||..|..:....||.|.|.:|....|     .|:..|::.||.
Human   125 RPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQC-----ERLFHGNYSRAT 184

  Fly   184 --C-----------KGDSGGPLVFDQQLVGVVSGGTKDCTYSSIYTSVPYFREWI 225
              |           |||||||||......|::|.|.|..|...:|..|.:|..||
Human   185 EICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 65/224 (29%)
Tryp_SPc 27..225 CDD:238113 65/223 (29%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 66/224 (29%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.