DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk1c8

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:266 Identity:84/266 - (31%)
Similarity:121/266 - (45%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLALNSLSAGPVIRP-EERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIIT 64
            |::....|:|:|....|.|   | :.|||||........||||::....:..|||.:.....:||
  Rat     1 MWLLILFLILSLGWNDAAP---PGQSRIIGGFNCEKNSQPWQVAVYHFNEPQCGGVLIHPSWVIT 62

  Fly    65 AAHCVQGQGYQVRAG--SALKNS--------------NGSVVDVAAIRTH-----EGLGNDIAIV 108
            |||| ....|||..|  :.|::.              .|..:|:  |:.|     ....||:.::
  Rat    63 AAHC-YSVNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPGFNLDI--IKNHTRKPGNDYSNDLMLL 124

  Fly   109 RLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSS--YYSHPIDLQGVNLYIQWPYYC----- 166
            .|..|.:.|:.|:.|.|....|..||....|||||.:  .:..|.|||.||:::.....|     
  Rat   125 HLKTPADITDGVKVIDLPTEEPKVGSTCLTSGWGSITPLKWEFPDDLQCVNIHLLSNEKCIKAYN 189

  Fly   167 -GLTEPSRICAGSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREWI 225
             .:|: ..:|||..  |:..|||||||||:.|..|.|:.|.|:..|   ...|:||.:..|..||
  Rat   190 DEVTD-VMLCAGEMDGGKDICKGDSGGPLICDGVLQGITSWGSMPCGEPNKPSVYTKLIKFTSWI 253

  Fly   226 LNAIDE 231
            ...:.|
  Rat   254 KKVMKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 74/232 (32%)
Tryp_SPc 27..225 CDD:238113 73/231 (32%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 74/232 (32%)
Tryp_SPc 25..256 CDD:238113 75/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.