DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk1c12

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_017444409.1 Gene:Klk1c12 / 292855 RGDID:1303192 Length:262 Species:Rattus norvegicus


Alignment Length:270 Identity:81/270 - (30%)
Similarity:120/270 - (44%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLALNSLSAGPVIRP-EERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIIT 64
            |::|...|.|::..:.|.|   | :.|::||........||||::  ..::||||.:.....:||
  Rat     1 MWLQILFLFLSVGRIDAAP---PGQSRVVGGYKCEKNSQPWQVAV--INRYLCGGVLIDPSWVIT 60

  Fly    65 AAHCVQG--QGYQVRAG--SALKNS--------NGSV----VDVAAIRTH-----EGLGNDIAIV 108
            ||||...  ..|.|..|  :..|:.        |.|.    .:...::.|     :...||:.::
  Rat    61 AAHCYSHALSNYHVLLGRNNLFKDEPFAQYRFVNQSFPHPDYNPFFMKNHTLFPGDDHSNDLMLL 125

  Fly   109 RLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSS--YYSHPIDLQGVNLYIQWPYYC----- 166
            .||:|.:.|:.|:.|.|....|..||....|||.|:.  .:..|.|||.||:.|.....|     
  Rat   126 HLSEPADITDGVKVIDLPTEEPKVGSTCLASGWSSTKPLEWEFPDDLQCVNINILSNEKCIKAHT 190

  Fly   167 GLTEPSRICAGSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREWIL 226
            .:.....:|||..  |:..|.|||||||:.|..|.|:.|..:..|   ...:|||.:..|..|  
  Rat   191 QMVTDVMLCAGELEGGKDTCNGDSGGPLLCDGVLQGITSWSSVPCGETNRPAIYTKLIKFTSW-- 253

  Fly   227 NAIDEIMSAN 236
              |.|:|..|
  Rat   254 --IKEVMKEN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 69/231 (30%)
Tryp_SPc 27..225 CDD:238113 68/230 (30%)
Klk1c12XP_017444409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.