DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Mcpt3

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001163937.1 Gene:Mcpt3 / 290244 RGDID:735036 Length:246 Species:Rattus norvegicus


Alignment Length:260 Identity:72/260 - (27%)
Similarity:110/260 - (42%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQ------VSIQRDGKHL--CGGSIYSA 59
            :|:.|.|:|| .|.:|   ...|.|||    |:|..|..      :.|..:..|:  |||.:.|.
  Rat     1 MQALLFLMAL-LLPSG---AGAEEIIG----GVESIPHSRPYMALLKIVTEEGHVTFCGGFLISH 57

  Fly    60 DIIITAAHCVQGQGYQVRAGSALKNSNGSVVDVAAIR------THEGLGN--DIAIVRLSKPLEF 116
            ..::||||| :|:...|..|:...:...|......:.      .:....|  ||.:::|.:....
  Rat    58 LFVMTAAHC-RGKEITVILGAHDMSKRESTQQKIKVEKQIFYPKYNFFSNFHDIMLLKLEEKAVL 121

  Fly   117 TNQVQPIPLAKTNP--PPGSIAFVSGWGSSSYYSHPID-LQGVNLYIQ-----WPYYCGLTEPSR 173
            |..|..|||.:::.  .||.:.:.:|||.:.......| |:.|.|.|.     | |:.......:
  Rat   122 TPTVNVIPLPQSSDFIKPGKMCWAAGWGRTGVTEPTSDTLREVKLRIMEKKACW-YFWHYDNRFQ 185

  Fly   174 ICAGS--FGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSSIYTSVPYFREWILNAIDEIMSAN 236
            ||.||  ..:...|.|||||||......|:||.|........|:|.:..:..|    ||.::..|
  Rat   186 ICVGSPEMLKLTYKEDSGGPLVCAGVAHGIVSHGRGRGKPPIIFTRISSYVPW----IDTVIKGN 246

  Fly   237  236
              Rat   247  246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 60/224 (27%)
Tryp_SPc 27..225 CDD:238113 60/223 (27%)
Mcpt3NP_001163937.1 Tryp_SPc 20..239 CDD:214473 61/228 (27%)
Tryp_SPc 21..242 CDD:238113 63/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.