DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and KLK5

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:244 Identity:76/244 - (31%)
Similarity:120/244 - (49%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AGPVIRPEE---RIIGGQPIGIEEAPWQVS-IQRDGKHLCGGSIYSADIIITAAHCVQGQGYQVR 77
            ||...|.::   |||.|....:...|||.: :.|..:..||..:.....::||||| :.:.::||
Human    54 AGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHC-RKKVFRVR 117

  Fly    78 AG----SALKNSNGSVVD-VAAI----RTHEGLGNDIAIVRLSKPLEFTNQVQPIPLAKTNPPPG 133
            .|    |.:..|...:.. |.:|    .:|.|..||:.:::|::.:..|..|:||.::...|..|
Human   118 LGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAG 182

  Fly   134 SIAFVSGWGS--SSYYSHPIDLQGVNLYIQWPYYCGLTEPSRI-----CAG-SFGRAACKGDSGG 190
            :...|||||:  |.....|..||.:|:.:.....|....|.:|     ||| ..||.:|:|||||
Human   183 TKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGG 247

  Fly   191 PLVFDQQLVGVVSGGTKDCTYSS---IYTSVPYFREWILNAIDEIMSAN 236
            |:|.:..|.|:||.|...|...:   :||::..|.:|    |.|.:.||
Human   248 PVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKW----IQETIQAN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 68/219 (31%)
Tryp_SPc 27..225 CDD:238113 67/218 (31%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 4/13 (31%)
Tryp_SPc 66..285 CDD:214473 69/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.