DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk1c2

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:270 Identity:84/270 - (31%)
Similarity:119/270 - (44%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLALNSLSAGPVIRP-EERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIIT 64
            |::|...|:|::..:.|.|   | :.||:||........||||::..:  :||||.:.....:||
  Rat     1 MWLQILSLVLSVGRIDAAP---PGQSRIVGGYKCEKNSQPWQVAVINE--YLCGGVLIDPSWVIT 60

  Fly    65 AAHCVQGQGYQVRAGSALKNSNGSVVD------------------VAAIRTHE------GLGNDI 105
            |||| ....|||..|     .|....|                  :..|.|::      ...||:
  Rat    61 AAHC-YSNNYQVLLG-----RNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDL 119

  Fly   106 AIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSS----YYSHPIDLQGVNLYIQWPYYC 166
            .::.||:|.:.|..|:.|.|....|..||....|||||::    ..||  |||.||:::.....|
  Rat   120 MLLHLSEPADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSH--DLQCVNIHLLSNEKC 182

  Fly   167 GLTEPSRI-----CAGSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDCT---YSSIYTSVPYF 221
            ..|....:     |||..  |:..|.|||||||:.|..|.|:.|||...|.   ..:||..:..|
  Rat   183 IETYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKF 247

  Fly   222 REWILNAIDE 231
            ..||...:.|
  Rat   248 TSWIKKVMKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 74/236 (31%)
Tryp_SPc 27..225 CDD:238113 73/235 (31%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 74/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.