DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG30025

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:250 Identity:102/250 - (40%)
Similarity:144/250 - (57%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALNSLSAGPVIRPE-------ERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIII 63
            |::||:..:.:.|..: ||       .||:||....|...|||:|:||.|.|.|||||||:::|:
  Fly     4 FVILLSAVACALGGTV-PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIV 67

  Fly    64 TAAHCVQGQG---YQVRAGSALKNSNGSVVDVAAIRTHEG-----LGNDIAIVRLSKPLEFTNQV 120
            |||||:|...   .|:||||:..:|.|....|::.:.|||     :.|||||::::..|.|::.:
  Fly    68 TAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTI 132

  Fly   121 QPIPLAKTNPPPGSIAFVSGWGSSSYYSH--PIDLQGVNLYIQWPYYCGLT--------EPSRIC 175
            :.|.||.:||..|:.|.|||||:.||.|.  |..||.||:.|.....|..:        ..:.||
  Fly   133 KAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMIC 197

  Fly   176 AGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSS---IYTSVPYFREWILN 227
            |.:.|:.||:||||||||....||||||.| ..|.||:   :|..|...|.|::|
  Fly   198 AAASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWVIN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 94/219 (43%)
Tryp_SPc 27..225 CDD:238113 93/218 (43%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 94/219 (43%)
Tryp_SPc 31..252 CDD:238113 94/221 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.