DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk7

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:250 Identity:84/250 - (33%)
Similarity:124/250 - (49%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQG 71
            ||.|||.:...|      ||||.|........||||::.:..:..|||.:.....::|||||..|
Mouse    12 LLSLALETAGQG------ERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMG 70

  Fly    72 QGYQVRAGSALKNSNGSVVDVAAIRT--HEGLG-----NDIAIVRLSKPLEFTNQVQPIPLAKTN 129
            | |||:.||. |..:.|...:.|.::  |.|..     |||.:|||.:|::.:::|:.:.|.:..
Mouse    71 Q-YQVQLGSD-KIGDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHC 133

  Fly   130 PPPGSIAFVSGWG--SSSYYSHPIDLQGVNLYIQWPYYC-----GLTEPSRICAG--SFGRAACK 185
            .|||:...|||||  :|...:.|.||...::.:.....|     .|...:.:|||  ......|.
Mouse   134 EPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCN 198

  Fly   186 GDSGGPLVFDQQLVGVVSGGTKDCTYSS---IYTSVPYFREWILNAIDEIMSANR 237
            ||||||||.:..|.|:||.||..|...:   :||.|..::.|::    |.|..:|
Mouse   199 GDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVM----ETMKTHR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 73/217 (34%)
Tryp_SPc 27..225 CDD:238113 72/216 (33%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 73/217 (34%)
Serine protease. /evidence=ECO:0000250 26..246 74/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.