DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Prss58

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_778185.1 Gene:Prss58 / 232717 MGIID:3608323 Length:241 Species:Mus musculus


Alignment Length:260 Identity:62/260 - (23%)
Similarity:106/260 - (40%) Gaps:50/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SFLLLLA--LNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHL-CGGSIYSADIIITAA 66
            :||.:|:  |.:.:..|     :.|.|..|      |:.|.::.|  :| |.|.:.....:||||
Mouse     4 AFLCILSTLLRTFAYNP-----DHIAGTTP------PYLVYLKSD--YLPCTGVLIHPLWVITAA 55

  Fly    67 HCVQGQGYQVRAGSALKN------SNGSVVDVAAIRTH-----EGLGNDIAIVRLSKPLEFTNQV 120
            || .....||..|  :.|      .:..|.|...|..|     ..:.:|:.:::|.:.::.:|..
Mouse    56 HC-NLPNLQVILG--ITNPADPMERDVEVSDYEKIFHHPNFLVSSISHDLLLIKLKRRIKHSNYA 117

  Fly   121 QPIPLAKTNPPPGSIAFVSGWGSS--SYYSHPIDLQGVNLYIQWPYYC-------GLTEPSRICA 176
            :.:.|.:......::..||.|..:  .....|..||.||:.:.....|       .:|| :.||.
Mouse   118 KAVKLPQHIVSVNAMCSVSTWAYNLCDVTKDPDSLQTVNVTVISKAECRNAYKAFDITE-NMICV 181

  Fly   177 GSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSS---IYTSVPYFREWILNAIDEIMSAN 236
            |..  .|..||..:..|.|.:..|.|::| ....|...:   ||.|:.::..|    |::.|..|
Mouse   182 GIVPGRRLPCKEVTAAPAVCNGVLYGILS-YADGCVLRADVGIYASIFHYLPW----IEDTMKNN 241

  Fly   237  236
            Mouse   242  241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 53/224 (24%)
Tryp_SPc 27..225 CDD:238113 53/223 (24%)
Prss58NP_778185.1 Tryp_SPc 29..237 CDD:238113 52/218 (24%)
Tryp_SPc 29..234 CDD:214473 51/215 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.