DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and PRSS54

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:252 Identity:67/252 - (26%)
Similarity:109/252 - (43%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLAL--NSLSAGPVIRPEERIIGGQP----IGIEEAPWQVSIQRDGK--HLCGGSIYSADIII 63
            |:||.|  :|.|.|  ::......|..|    :...|.||.||:| |.:  ||..|.|.|...::
Human    18 LVLLGLLYSSTSCG--VQKASVFYGPDPKEGLVSSMEFPWVVSLQ-DSQYTHLAFGCILSEFWVL 79

  Fly    64 TAAHCVQG-QGYQVRAGSALKNSNGSVV-----DVAAIRTHE-----GLGNDIAIVRLSKPLEFT 117
            :.|..:|. :...|..|  :.|.:.|.:     .|..|..||     .:.|:||:::....:.|.
Human    80 SIASAIQNRKDIVVIVG--ISNMDPSKIAHTEYPVNTIIIHEDFDNNSMSNNIALLKTDTAMHFG 142

  Fly   118 NQVQPIPLAKT---NPPPGSIAFVSGWGSSSYYSHPIDLQGV-NLYIQWPYYCGLTEPSRICAGS 178
            |.||.|.....   .||.....:||||..:|...:.:.:..: .::::....|.|.:..:...||
Human   143 NLVQSICFLGRMLHTPPVLQNCWVSGWNPTSATGNHMTMSVLRKIFVKDLDMCPLYKLQKTECGS 207

  Fly   179 F----GRAACKGDSGGPLVFDQQ------LVGVVSGGTKDCTYSSIYTSVPYFREWI 225
            .    .:.||.||.|.|::...|      |.||::.|.:.|....:||.|..:.:||
Human   208 HTKEETKTACLGDPGSPMMCQLQQFDLWVLRGVLNFGGETCPGLFLYTKVEDYSKWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 58/229 (25%)
Tryp_SPc 27..225 CDD:238113 58/228 (25%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 56/214 (26%)
Tryp_SPc 52..264 CDD:238113 56/214 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.