DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk1b4

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:270 Identity:83/270 - (30%)
Similarity:123/270 - (45%) Gaps:49/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITA 65
            |:.....|.|:|..:.|.|.::.:......|       ||.|::.|..|:.|||.:...:.::||
Mouse     1 MWFLILFLALSLGGIDAAPPVQSQVDCENSQ-------PWHVAVYRFNKYQCGGVLLDRNWVLTA 58

  Fly    66 AHCVQGQGYQVRAGSALKNS----------------------NGSVVDVAAIRTHEGLGNDIAIV 108
            |||...: |||..|   ||:                      |.|:::....:..:...||:.::
Mouse    59 AHCYNDK-YQVWLG---KNNFLEDEPSDQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLL 119

  Fly   109 RLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSS--YYSHPIDLQGVNLYIQWPYYCGLTEP 171
            |||||.:.|:.|:||.|....|..||....|||||::  .:.:|.|||.|||.:.....|.....
Mouse   120 RLSKPADITDVVKPITLPTEEPKLGSTCLASGWGSTTPIKFKYPDDLQCVNLKLLPNEDCDKAHE 184

  Fly   172 SRI-----CAGSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREWIL 226
            .::     |||..  |...|:.||||||:.|..|.|:.|.|.:.|   |..|:||.:..|..|  
Mouse   185 MKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSW-- 247

  Fly   227 NAIDEIMSAN 236
              |.|.|:.|
Mouse   248 --IRETMANN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 72/232 (31%)
Tryp_SPc 27..225 CDD:238113 72/231 (31%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 76/252 (30%)
Activation peptide homolog 18..24 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.