DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Mcpt8

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_032598.1 Gene:Mcpt8 / 17231 MGIID:1261780 Length:247 Species:Mus musculus


Alignment Length:239 Identity:75/239 - (31%)
Similarity:112/239 - (46%) Gaps:22/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQ-RDGK--HLCGGSIYSADIIITAAH 67
            ||||:.|  ::|.||......||.|........|:...|: .|.|  :.|||.:.:.||::||||
Mouse     2 FLLLVLL--VAALPVNAEGGEIIWGTESKPHSRPYMAYIRFNDSKSVYRCGGFLVARDIVMTAAH 64

  Fly    68 CVQGQGYQVRAG--SALKNSNGSVVDVAAIRTHEG-----LGNDIAIVRLSKPLEFTNQVQPIPL 125
            | .|:...|..|  :..|..|..::.|:....||.     |.|||.:::|.:..:..:.|..|.|
Mouse    65 C-NGKVINVTLGIHNLKKKKNTQLIPVSEAIPHESFDNETLVNDIMLLKLERKAQLNSAVDTIAL 128

  Fly   126 AKTNP--PPGSIAFVSGWGSSSYYSHPIDLQGVNLYIQWPYYC-----GLTEPSRICAG--SFGR 181
            .|:..  .||.:..|:|||..:..:....||.|||.:|....|     ...:..::|.|  |..:
Mouse   129 PKSKDWVKPGQVCTVAGWGKLANCTLSDTLQEVNLEVQKGQKCRSMSQTYNDSIQLCVGNPSENK 193

  Fly   182 AACKGDSGGPLVFDQQLVGVVSGGTKDCTYSSIYTSVPYFREWI 225
            |..|||||||.|.:..:.|:||......|...::|.:..|..||
Mouse   194 ATGKGDSGGPFVCNGVVQGIVSCRLCTGTLPRVFTRISSFMPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 65/217 (30%)
Tryp_SPc 27..225 CDD:238113 65/216 (30%)
Mcpt8NP_032598.1 Tryp_SPc 20..237 CDD:214473 65/217 (30%)
Tryp_SPc 21..240 CDD:238113 67/218 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.