DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk1b1

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:265 Identity:79/265 - (29%)
Similarity:122/265 - (46%) Gaps:44/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITA 65
            |:.....|.|:|..:.|.|.:  :.||:||........||.|::.|..:::|||.:..|:.::||
Mouse     1 MWFLILFLALSLGGIDAAPPV--QSRIVGGFKCEKNSQPWHVAVYRYKEYICGGVLLDANWVLTA 63

  Fly    66 AHCVQGQG---------YQVRAGSALKNSNGSVV----DVAAIRT-----HEGLGNDIAIVRLSK 112
            |||...:.         ||....:..:..:.|.:    :::..|.     .:....|:.::||||
Mouse    64 AHCYYEKNNVWLGKNNLYQDEPSAQHRLVSKSFLHPCYNMSLHRNRIQNPQDDYSYDLMLLRLSK 128

  Fly   113 PLEFTNQVQPIPLAKTNPPPGSIAFVSGWGS--SSYYSHPIDLQGVNL-----------YIQWPY 164
            |.:.|:.|:||.|....|..||....|||||  ...:.:..|||.|||           |:|   
Mouse   129 PADITDVVKPIALPTEEPKLGSTCLASGWGSIIPVKFQYAKDLQCVNLKLLPNEDCDKAYVQ--- 190

  Fly   165 YCGLTEPSRICAG--SFGRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREW 224
              .:|: ..:|||  ..|:..|||||||||:.|..|.|:.|.|...|   ....:||.:..|..|
Mouse   191 --KVTD-VMLCAGVKGGGKDTCKGDSGGPLICDGVLQGLTSWGYNPCGEPKKPGVYTKLIKFTSW 252

  Fly   225 ILNAI 229
            |.:.:
Mouse   253 IKDTL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 71/234 (30%)
Tryp_SPc 27..225 CDD:238113 70/233 (30%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 71/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.