DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk1b27

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_064664.1 Gene:Klk1b27 / 16619 MGIID:891980 Length:263 Species:Mus musculus


Alignment Length:264 Identity:81/264 - (30%)
Similarity:119/264 - (45%) Gaps:55/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLL---LALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAH 67
            ||:|   |:|..:.|.|.:  :.|||||........||.|::.|..|::|||.:...:.::||||
Mouse     3 FLILFLALSLGGIDAAPPV--QSRIIGGFKCKKNSQPWHVAVLRSNKYICGGVLLDPNWVLTAAH 65

  Fly    68 CVQGQGYQ-----------VRAGSA-----LKNSNGSVVDVAAIRTH----EGLGNDIAIVRLSK 112
            |......|           .|..||     .|:......:::.:..|    |...||:.::||||
Mouse    66 CYGNDTSQHNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDHIPHPEDKSNDLMLLRLSK 130

  Fly   113 PLEFTNQVQPIPLAKTNPPPGSIAFVSGWGS--SSYYSHPIDLQGVNLYIQWPYYCGLTEPSRIC 175
            |.:.|:.|:||.|....|..||....|||||  .:.|..|.|||.|.:.:.         |:..|
Mouse   131 PADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKYQIPNDLQCVFIKLL---------PNENC 186

  Fly   176 AGSF----------------GRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSS---IYTSVPYF 221
            |.::                |:..|||||||||:.|..|.|:.|.|:..|...:   ::|.:..|
Mouse   187 AKAYVHKVTDVMLCVGETGGGKGTCKGDSGGPLICDGVLHGITSWGSIPCAKPNAPGVFTKLIKF 251

  Fly   222 REWI 225
            ..||
Mouse   252 TSWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 72/239 (30%)
Tryp_SPc 27..225 CDD:238113 71/238 (30%)
Klk1b27NP_064664.1 Tryp_SPc 24..255 CDD:214473 72/239 (30%)
Tryp_SPc 25..258 CDD:238113 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.