DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Gzmc

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_006518631.1 Gene:Gzmc / 14940 MGIID:109256 Length:279 Species:Mus musculus


Alignment Length:242 Identity:72/242 - (29%)
Similarity:105/242 - (43%) Gaps:29/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQV---SIQRDGKHL-CGGSIYSADIIITAAH 67
            :||..|..|.||     .|.||||..|.....|:..   .::..||.: |||.:.....::||||
Mouse    37 ILLTLLLPLRAG-----AEEIIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAH 96

  Fly    68 CVQGQGYQVRAGS---ALKNSNGSVVDVAAIRTH-----EGLGNDIAIVRLSKPLEFTNQVQPIP 124
            | :|....|..|:   ..|.....::.||....|     :...|||.:::|.:..:.|..|:|:.
Mouse    97 C-KGSSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLN 160

  Fly   125 LAKTNP--PPGSIAFVSGWGS-SSYYSHPIDLQGVNLYIQWPYYC------GLTEPSRICAG--S 178
            |.:.|.  .||...:|:|||. :.....|..|..|.|.:|....|      .....:.||.|  .
Mouse   161 LPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSK 225

  Fly   179 FGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSSIYTSVPYFREWI 225
            ...|:.:.|||||||..:...|:||.|..|.:...::|.|..|..||
Mouse   226 IKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 63/221 (29%)
Tryp_SPc 27..225 CDD:238113 63/220 (29%)
GzmcXP_006518631.1 Tryp_SPc 52..275 CDD:238113 65/222 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.