DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and si:dkey-78l4.7

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_003201098.1 Gene:si:dkey-78l4.7 / 100034654 ZFINID:ZDB-GENE-060503-176 Length:257 Species:Danio rerio


Alignment Length:269 Identity:78/269 - (28%)
Similarity:117/269 - (43%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLAL-----NSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSAD 60
            :.|.|.|||::|     .|...|        |:.|........|:.||:|:..:|:|||.:.|..
Zfish     3 IIIISLLLLVSLVPHLTFSAHVG--------IVNGTEAKPHSRPYMVSLQKGFQHVCGGFLISEK 59

  Fly    61 IIITAAHCVQGQGYQVRAGSA--LKN-SNGSV-VDVAAIRTHEGL-----GNDIAIVRLSKPLEF 116
            .::|||||..|.........|  |:| |..|| :.|.:...|...     .||:.:::|.|.::.
Zfish    60 FVLTAAHCRMGNEILTAVVGAHNLRNRSEKSVRMKVKSYHLHPDFTVKPWRNDVMLLKLVKKVQL 124

  Fly   117 TNQVQPIPLAK--TNPPPGSIAFVSGWGSSSY---YSHPIDLQGVNLY------IQWPYYCGLTE 170
            ...|:.|.::|  .:..|.|...|:||...|:   .|..:...||.:.      .:|.   .:..
Zfish   125 NKNVKIISMSKQERDIKPDSACAVAGWEKLSFKGKVSTQLMEAGVKIMNNTECENKWK---KIYL 186

  Fly   171 PSR-ICAGSFGRAACKGDSGGPLVFDQQLVGVVS-GGTKDCT---YSSIYTSVPYFREWILNAID 230
            ||: ||....| .:|.||||||||.:...|||.| |..:.|.   ...:|..:..|..|    ||
Zfish   187 PSQMICVYGHG-GSCGGDSGGPLVCEDTAVGVTSFGDARVCNSRKRPEVYMKISEFLPW----ID 246

  Fly   231 EIM-SANRN 238
            .|: :..||
Zfish   247 SIIGNKGRN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 64/223 (29%)
Tryp_SPc 27..225 CDD:238113 64/222 (29%)
si:dkey-78l4.7XP_003201098.1 Tryp_SPc 26..248 CDD:238113 67/229 (29%)
Tryp_SPc 26..245 CDD:214473 65/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434182at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.