DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33090 and APL3

DIOPT Version :9

Sequence 1:NP_788055.2 Gene:CG33090 / 34835 FlyBaseID:FBgn0028916 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_009516.1 Gene:APL3 / 852243 SGDID:S000000133 Length:1025 Species:Saccharomyces cerevisiae


Alignment Length:343 Identity:64/343 - (18%)
Similarity:121/343 - (35%) Gaps:103/343 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 YDDPRLAYGRFGYLEGHEYRMYNTYDVHFYA---SPALAHLWPNLQVSLQYDFKDAIAAEL---N 555
            :|..:...|....|.|::.:.|.....:.|.   :..|..:...|:.:::. .|.:|.:|.   .
Yeast    53 FDAAKKKQGNHDRLGGYQRKKYVAKLAYIYITSNTTKLNEILFGLEQTVEL-LKSSIFSEKFIGY 116

  Fly   556 DTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDWKDLNT---KFVLQVYRDYY 617
            .|.::||:...:..||.          ||..:.|:           |||::   .||:.......
Yeast   117 MTLELLYERSEVVAKVN----------DEVNYQLM-----------KDLSSSDDNFVMLALNFVG 160

  Fly   618 VLNELAQ--AQSDN---------ASKFSSIEFIDKESL---------YELYSQDNKRK------- 655
            |:.||..  |.:|:         .|..|||....|.:|         :.:.::|.:||       
Yeast   161 VVGELTNRLAYNDDITTGVFKILRSPTSSIYLKKKSALSFLALLKSNHSILTEDLQRKQLWIQRI 225

  Fly   656 -NSADEKQQNRKSASMYINETNGKVYLMDAIG-YLKAMYASCKAIMERTIEY-----------DK 707
             :..|:.:..|.        |...:.|::.|. |:...|  |..::.:..|.           ..
Yeast   226 LSLLDDTENYRL--------TLATIPLIEFIAKYIDPSY--CTRLLPQLTEILYNCVVVGTSRSS 280

  Fly   708 DNDGLIENT--KMPDQTYDSWVMD-----------GPSAYCSGLWLAALQAMSAMATILDQPNDC 759
            ||...:|.|  .||    :.|::.           .|:...||   :.||..:....:|::...|
Yeast   281 DNQFPLEYTFANMP----NPWLITKVVSLLSILIASPTERDSG---SLLQTNNIDNELLNKLRKC 338

  Fly   760 LRYQDILEKGKRSLEEKL 777
            :..  .:|.|.|..::.:
Yeast   339 VSV--AIELGTRQAQDPM 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33090NP_788055.2 GBA2_N 132..445 CDD:289023
DUF608 505..937 CDD:282531 63/335 (19%)
APL3NP_009516.1 Adaptin_N 38..649 CDD:396262 64/343 (19%)
Alpha_adaptin_C 901..1018 CDD:367023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.