DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33090 and g

DIOPT Version :9

Sequence 1:NP_788055.2 Gene:CG33090 / 34835 FlyBaseID:FBgn0028916 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_524785.2 Gene:g / 44819 FlyBaseID:FBgn0001087 Length:1034 Species:Drosophila melanogaster


Alignment Length:245 Identity:53/245 - (21%)
Similarity:86/245 - (35%) Gaps:82/245 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 IAAELNDTRKMLYDGKVMP------RKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDWKDLNTKF 608
            :|.|:.....:|:.|:::|      |||.  :|..|                 |:::|       
  Fly   603 LAIEIVQEMTLLFTGELIPVAPKAQRKVP--LPDGL-----------------DLDEW------- 641

  Fly   609 VLQVYRDYYVLNELAQAQSDNASKFSSIEFIDKESLYELYSQ-------DNKRKNSAD--EKQQN 664
                      :|  |....|.||..||..  ||:.|:...:|       ..||:.|.:  .:|..
  Fly   642 ----------IN--APPPEDAASSSSSEH--DKDELFVSATQAGTGADGGEKRRQSLELTPEQLE 692

  Fly   665 RKSASMYINETNGKVYLMDAIGYLKAMYASCKAIMERTIEYDKDNDGLIENTKMPDQTYDSWVMD 729
            |:..:..|.::|...||........|..|.         :||..:|  |..|::|..      |:
  Fly   693 RQRMARLIEQSNNPHYLKSTPTASGASNAD---------QYDNIDD--IPITELPLD------ME 740

  Fly   730 GPSAYCSGLWLAA---LQAMSAMATILDQPNDCLRYQDILEKGKRSLEEK 776
            |.:|...|:...:   ||...|.....|....       .:|||:|.:.|
  Fly   741 GVAALRVGITKRSDKYLQEQQAAQGSKDGKKK-------HKKGKKSKKAK 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33090NP_788055.2 GBA2_N 132..445 CDD:289023
DUF608 505..937 CDD:282531 53/245 (22%)
gNP_524785.2 Adaptin_N 33..578 CDD:279882
HEAT repeat 152..173 CDD:293787
HEAT repeat 185..213 CDD:293787
Cnd1 <193..266 CDD:289487
HEAT repeat 221..263 CDD:293787
HEAT repeat 272..290 CDD:293787
HEAT repeat 302..331 CDD:293787
BLVR 687..840 CDD:283923 27/121 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.