DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33090 and AP-2alpha

DIOPT Version :9

Sequence 1:NP_788055.2 Gene:CG33090 / 34835 FlyBaseID:FBgn0028916 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_995607.1 Gene:AP-2alpha / 33211 FlyBaseID:FBgn0264855 Length:952 Species:Drosophila melanogaster


Alignment Length:822 Identity:146/822 - (17%)
Similarity:256/822 - (31%) Gaps:280/822 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 CSTRDKTSDPDGDPDGERTKCQLPNCSSRAKQPLSAWHSNIEDTRCS-YTGLYPRSWTEYDLSHY 239
            |..|...|.||..|.||.|        ||....|:..|..:.....| ...|..|:..||.    
  Fly   182 CLLRLFRSSPDIIPGGEWT--------SRIIHLLNDQHMGVVTAATSLIDALVKRNPDEYK---- 234

  Fly   240 G-VRLTCRQVSPVIPHEYRESSLPCAVFV---W-SVE--------NVCDQERKVSITFTFKNGT- 290
            | |.|...::|.::...|.:.......||   | ||:        |...:|..|....   |.| 
  Fly   235 GCVNLAVSRLSRIVTASYTDLQDYTYYFVPAPWLSVKLLRLLQNYNPVTEEAGVRARL---NETL 296

  Fly   291 ---GNKKQDAEGGAESQLISEGNAKGVSIRQKI-------SEMPCSYNLACRVLPEISITRCPQF 345
               .||.|:.   .:|:.:...|||...:.:.|       ||            |.:.:..|.|.
  Fly   297 ETILNKAQEP---PKSKKVQHSNAKNAVLFEAINLIIHSDSE------------PNLLVRACNQL 346

  Fly   346 DPAGNGEQLWAQLKEHGQ-LSEHPTS-EALKTKDIGVAVCGQVALKPMASHDLEFVLAWDMPKIQ 408
                            || ||...|: ..|..:.:......:.:.:.:..|....:|:..|.|..
  Fly   347 ----------------GQFLSNRETNLRYLALESMCHLATSEFSHEEVKKHQEVVILSMKMEKDV 395

  Fly   409 FPRKMQTHTRYYTKYFDDSGDSGPRICE----YALRQYSTWERLIDAWQRPILNDETLPD--WYK 467
            ..|:|.....|   ...|.|::...:.|    .....||..|.::  .:..||.::...|  ||.
  Fly   396 SVRQMAVDLLY---AMCDRGNAEEIVQEMLNYLETADYSIREEMV--LKVAILAEKYATDYTWYV 455

  Fly   468 CAIFNQLYFISD--GGTIWLKCDSSLGKELAYDDPRLAYGRFGYLEGHEYR----MYNTYDVHFY 526
            ..|.|.:....|  ...:|                              ||    :.|..:|..|
  Fly   456 DVILNLIRIAGDYVSEEVW------------------------------YRVIQIVINREEVQGY 490

  Fly   527 ASPALAHLWPNLQVSLQYDFKDAIAAELNDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLIN 591
            |:..:            ::...|.|...|    |:..|..:..:..|.:   .||....|..   
  Fly   491 AAKTV------------FEALQAPACHEN----MVKVGGYILGEFGNLI---AGDSRSAPLV--- 533

  Fly   592 CYNIHDVNDWKDLNTKFVLQVYRDYYVLNELAQAQSDNASKFSSIEFID-----KESLYELYSQD 651
                    .:|.|::|        |::.:.:.:|    ....:.|:||:     :.::.:::.|.
  Fly   534 --------QFKLLHSK--------YHLCSPMTRA----LLLSTYIKFINLFPEIRTNIQDVFRQH 578

  Fly   652 NKRKNSADEKQQNRKSASMYIN---ETNGKVYLMDAIGYLKAMYASCKAIMERTIEYDKDNDGLI 713
            :..: |||.:.|.|.|..:.::   .|:....:::.:.......:|..|::::            
  Fly   579 SNLR-SADAELQQRASEYLQLSIVASTDVLATVLEEMPSFPERESSILAVLKK------------ 630

  Fly   714 ENTKMPDQTYDSWVMDGPSAYCSGLWLAALQAMSAMATILDQPNDCLRYQDILEKGKRSLEEKLW 778
               |.|.:..::.:.:..|              .|..|...|.|                  .|.
  Fly   631 ---KKPGRVPENEIRESKS--------------PAPLTSAAQNN------------------ALV 660

  Fly   779 NGSYYRFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGNIGA 843
            |.|:.:.:.|:::.|.:....                 |..|                   |||:
  Fly   661 NNSHSKLNNSNANTDLLGLST-----------------PPSN-------------------NIGS 689

  Fly   844 ANGFIANASEPTKPGHVDNSNIQAEEVW---------PGVVYALAATMIQEGMFEEAFQTAGGMY 899
            .:...:...:.....:..|||..:..|:         .||::  ...|:|.|:..|..|..|   
  Fly   690 GSNSNSTLIDVLGDMYGSNSNNNSSAVYNTKKFLFKNNGVLF--ENEMLQIGVKSEFRQNLG--- 749

  Fly   900 KTLSQRIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVALE 941
                 |:|:       .||.|....:....|:..||.:.||:
  Fly   750 -----RLGL-------FYGNKTQVPLTNFNPVLQWSAEDALK 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33090NP_788055.2 GBA2_N 132..445 CDD:289023 64/299 (21%)
DUF608 505..937 CDD:282531 70/452 (15%)
AP-2alphaNP_995607.1 Adaptin_N 40..598 CDD:279882 104/539 (19%)
Alpha_adaptinC2 730..839 CDD:197886 16/67 (24%)
Alpha_adaptin_C 839..947 CDD:280460
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.