DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33090 and Ap3d1

DIOPT Version :9

Sequence 1:NP_788055.2 Gene:CG33090 / 34835 FlyBaseID:FBgn0028916 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_001094189.1 Gene:Ap3d1 / 314633 RGDID:1308659 Length:1204 Species:Rattus norvegicus


Alignment Length:180 Identity:43/180 - (23%)
Similarity:67/180 - (37%) Gaps:51/180 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 HYGVRLTCRQVSPVIPHEYRESSLPCAVFVWSVEN-VCDQERKVSITFTFKNGTGNKKQDAEGGA 301
            |.||.:.. |:.|.:.:|        |.||::::: |..|:.|.:::|..|        |.||..
  Rat  1036 HDGVPVPF-QLPPGVSNE--------AQFVFTIQSIVMAQKLKGTLSFIAK--------DDEGAT 1083

  Fly   302 ESQLISEGNAKGVSIRQKISEMPCSYNLACRVLPEISITRCPQFDPAGNGEQLWAQLKEHGQLSE 366
            ..:|         ..|...|   ||..|         || .|.:..|      :|:|.|.|.|| 
  Rat  1084 HEKL---------DFRLHFS---CSSYL---------IT-TPCYSDA------FAKLLESGDLS- 1119

  Fly   367 HPTSEALKTKDIGVAVCGQVALKPMASHDLEFVLAWDMPKIQFPRKMQTH 416
               ..::|...|.::....:| |....|....|...|.....:.|.:|.|
  Rat  1120 ---MNSIKVDGISISFQNLLA-KICFYHHFSVVERVDSCASMYSRSIQGH 1165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33090NP_788055.2 GBA2_N 132..445 CDD:289023 43/180 (24%)
DUF608 505..937 CDD:282531
Ap3d1NP_001094189.1 Adaptin_N 32..581 CDD:279882
HEAT repeat 151..172 CDD:293787
Cnd1 155..265 CDD:289487
HEAT repeat 184..212 CDD:293787
HEAT repeat 220..262 CDD:293787
HEAT repeat 271..292 CDD:293787
HEAT repeat 301..330 CDD:293787
HEAT repeat 335..364 CDD:293787
BLVR 661..803 CDD:283923
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.