DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33090 and AP1G1

DIOPT Version :9

Sequence 1:	NP_788055.2	Gene:	CG33090 / 34835	FlyBaseID:	FBgn0028916	Length:	948	Species:	Drosophila melanogaster
Sequence 2:	NP_001025178.1	Gene:	AP1G1 / 164	HGNCID:	555	Length:	825	Species:	Homo sapiens

Alignment Length:	112	Identity:	30/112 - (26%)
Similarity:	43/112 - (38%)	Gaps:	26/112 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 PLAVETKPLSNGN------ANGNAVGIAESASA------VFQEKL---KLQQQEESNEIAA-VP- 51
            |.|..:||.|.|.      .:.|..|...:|.|      :.|...   .|..|...|:||| :|
Human   645 PTAPTSKPSSAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPS 709

  Fly    52 -----KYGLKLKF----DHVWPEKRIQNVRASIRQTLPMVPLVCRYA 89
                 |.|||::|    .:..|...:..::||....|.|...|.:.|
Human   710 ITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAA 756

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33090	NP_788055.2	GBA2_N	132..445	CDD:289023
CG33090	NP_788055.2	DUF608	505..937	CDD:282531
AP1G1	NP_001025178.1	Adaptin_N	23..577	CDD:396262
		HEAT repeat	142..163	CDD:293787
		HEAT repeat	175..203	CDD:293787
		HEAT repeat	246..276	CDD:293787
		HEAT repeat	287..319	CDD:293787
		Herpes_BLLF1	<593..>654	CDD:282904	4/8 (50%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	600..631
		Alpha_adaptinC2	712..820	CDD:197886	12/45 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4354
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900