DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33090 and AP2A2

DIOPT Version :9

Sequence 1:NP_788055.2 Gene:CG33090 / 34835 FlyBaseID:FBgn0028916 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_001229766.1 Gene:AP2A2 / 161 HGNCID:562 Length:940 Species:Homo sapiens


Alignment Length:502 Identity:84/502 - (16%)
Similarity:152/502 - (30%) Gaps:195/502 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 ISITRC--PQFDPAGNGEQLWAQLKEHGQLSEHPTSEALKTKDIGVAVCGQVALKPMASHDLEFV 399
            :.:.:|  |..|||..|...........:..|.|.|:.::..:...||..: |:..:..||.|  
Human   262 LRLLQCYPPPEDPAVRGRLTECLETILNKAQEPPKSKKVQHSNAKNAVLFE-AISLIIHHDSE-- 323

  Fly   400 LAWDMPKI---------QFPRKMQTHTRYYTKYFDDSGDSGPRICEYALRQYS------------ 443
                 |.:         ||.:..:|:.||...         ..:|..|..::|            
Human   324 -----PNLLVRACNQLGQFLQHRETNLRYLAL---------ESMCTLASSEFSHEAVKTHIETVI 374

  Fly   444 ---TWERLIDAWQRPILNDETLPDWYKCAIFNQLYFISDGGTIWLKCDSSLGKELAYDDPRLAYG 505
               ..||.:...||.:                        ..::..||.|       :.|::...
Human   375 NALKTERDVSVRQRAV------------------------DLLYAMCDRS-------NAPQIVAE 408

  Fly   506 RFGYLEGHEYRMYN-------------TYDVHFYASPAL-----------AHLWPN-LQVSLQYD 545
            ...|||..:|.:..             ..|..:|....|           ..:|.. :|:.:..|
Human   409 MLSYLETADYSIREEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRD 473

  Fly   546 FKDAIAAELNDTRKMLYDGKVMPRKVKNCVPHD-----------LGDPDEEPFTLINCYNIHDVN 599
            .....||      |.:::....|...:|.|...           .|||...|  ||..:.:|...
Human   474 DVQGYAA------KTVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSP--LIQFHLLHSKF 530

  Fly   600 DWKDLNTK-FVLQVYRDYYVLNELAQAQSDNASKFSSIEFID-----KESLYELYSQDNKRKNSA 658
            ....:.|: .:|..|                      |:|::     |.::.::...|::.:|:.
Human   531 HLCSVPTRALLLSTY----------------------IKFVNLFPEVKPTIQDVLRSDSQLRNAD 573

  Fly   659 DEKQQNRKSASMYINETNGKVYLMDAIGYLKAMYASCKAIMERTIEY-----DKDNDGL------ 712
            .|.||.                   |:.||:....:...|:...:|.     ::::..|      
Human   574 VELQQR-------------------AVEYLRLSTVASTDILATVLEEMPPFPERESSILAKLKKK 619

  Fly   713 --------IENTKMPDQTYDSWVMDGPSAYCSGLWLAALQAMSAMAT 751
                    :|:||. |::.|  |..||.        .|..:.||::|
Human   620 KGPSTVTDLEDTKR-DRSVD--VNGGPE--------PAPASTSAVST 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33090NP_788055.2 GBA2_N 132..445 CDD:289023 24/133 (18%)
DUF608 505..937 CDD:282531 52/308 (17%)
AP2A2NP_001229766.1 Lipid-binding 5..80
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250|UniProtKB:P18484 11..12
Adaptin_N 29..591 CDD:279882 69/425 (16%)
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250|UniProtKB:P18484 57..61
Cnd1 <163..>235 CDD:289487
HEAT repeat 332..355 CDD:293787 5/31 (16%)
HEAT repeat 369..398 CDD:293787 4/52 (8%)
HEAT repeat 408..434 CDD:293787 4/25 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 613..682 13/54 (24%)
Alpha_adaptinC2 718..821 CDD:197886
Alpha_adaptin_C 827..935 CDD:280460
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.