DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33090 and Ap3d1

DIOPT Version :9

Sequence 1:NP_788055.2 Gene:CG33090 / 34835 FlyBaseID:FBgn0028916 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_031486.1 Gene:Ap3d1 / 11776 MGIID:107734 Length:1199 Species:Mus musculus


Alignment Length:185 Identity:42/185 - (22%)
Similarity:72/185 - (38%) Gaps:51/185 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 DQERKVSITFTFKNGTGNKKQ----DAEGGAESQLISEGNAKGVSIRQKISEMP--CSYNLACRV 333
            |||||.|.....|:....:|:    |.:...:.|:....|  |.:..::...:|  .||.|... 
Mouse   912 DQERKSSRHKKKKHRKEKEKEERPRDKKKAKKKQVAPLEN--GAAAEEEEEPIPPMSSYCLLAE- 973

  Fly   334 LPEISITRCPQFDPAGNGEQLWAQLKEHGQLS-----EHPTSEALKTKDI--------------- 378
            .|.|.:|    :|       :.|.|::..|::     |:.:|..||..::               
Mouse   974 SPYIKVT----YD-------IQASLQKDSQVTVSIILENQSSSFLKNMELNVLDSLNTKMTRPEG 1027

  Fly   379 -----GVAVCGQVALKPMASHDLEFVLAWDMPKIQFPRKMQTHTRYYTKYFDDSG 428
                 ||.|..|  |.|..|::.:||  :.:..|...:|::....:..|  ||.|
Mouse  1028 SSVHDGVPVPFQ--LPPGVSNEAQFV--FTIQSIVMAQKLKGTLSFIAK--DDEG 1076

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33090NP_788055.2 GBA2_N 132..445 CDD:289023 42/185 (23%)
DUF608 505..937 CDD:282531
Ap3d1NP_031486.1 Adaptin_N 32..581 CDD:279882
HEAT 1 34..71
HEAT 2 142..179
HEAT repeat 151..172 CDD:293787
Cnd1 155..265 CDD:289487
HEAT 3 180..216
HEAT repeat 184..212 CDD:293787
HEAT 4 218..254
HEAT repeat 220..262 CDD:293787
HEAT 5 257..296
HEAT repeat 271..292 CDD:293787
HEAT 6 298..336
HEAT repeat 301..330 CDD:293787
HEAT repeat 335..364 CDD:293787
HEAT 7 337..373
HEAT 8 375..409
HEAT 9 521..558
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..695
BLVR 661..803 CDD:283923
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 724..963 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.