powered by:
Protein Alignment CG33090 and Ap1g2
DIOPT Version :9
Sequence 1: | NP_788055.2 |
Gene: | CG33090 / 34835 |
FlyBaseID: | FBgn0028916 |
Length: | 948 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_031481.2 |
Gene: | Ap1g2 / 11766 |
MGIID: | 1328307 |
Length: | 791 |
Species: | Mus musculus |
Alignment Length: | 47 |
Identity: | 15/47 - (31%) |
Similarity: | 23/47 - (48%) |
Gaps: | 16/47 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 LKLQQQEESNEIAAVPKYGLKLKFDHVWPEKRIQNVRASIRQTLPMV 82
|:|||: ||....|..|:|| :||:|.:.:|:|
Mouse 558 LELQQR-------AVEYNTLFQKYDH---------MRAAILEKMPLV 588
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4354 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.