DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33090 and Ap1g2

DIOPT Version :9

Sequence 1:NP_788055.2 Gene:CG33090 / 34835 FlyBaseID:FBgn0028916 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_031481.2 Gene:Ap1g2 / 11766 MGIID:1328307 Length:791 Species:Mus musculus


Alignment Length:47 Identity:15/47 - (31%)
Similarity:23/47 - (48%) Gaps:16/47 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKLQQQEESNEIAAVPKYGLKLKFDHVWPEKRIQNVRASIRQTLPMV 82
            |:|||:       ||....|..|:||         :||:|.:.:|:|
Mouse   558 LELQQR-------AVEYNTLFQKYDH---------MRAAILEKMPLV 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33090NP_788055.2 GBA2_N 132..445 CDD:289023
DUF608 505..937 CDD:282531
Ap1g2NP_031481.2 Adaptin_N 24..575 CDD:279882 8/23 (35%)
Alpha_adaptinC2 678..786 CDD:197886
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.