DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15286 and CG42585

DIOPT Version :9

Sequence 1:NP_001285929.1 Gene:CG15286 / 34834 FlyBaseID:FBgn0028531 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001162977.1 Gene:CG42585 / 8674069 FlyBaseID:FBgn0260953 Length:349 Species:Drosophila melanogaster


Alignment Length:282 Identity:73/282 - (25%)
Similarity:111/282 - (39%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HERIECKGCGKRSLTFRCYRCLSCQDFDICEECYDNDFTTSTHPFDHPVVCV-----LIPADVEL 65
            |..|.|.||.........:|||.|.::::|:.|||:...|..|..:||:...     |:|.   |
  Fly     3 HRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLFPDSDDLVPL---L 64

  Fly    66 YFGGE-----YISNYPPQSYRCPYCKRWGFNESTFLEHVSAMHPDASPLLVSTM-VGLFEQQQAA 124
            |  ||     ::||    .:.||:|.........|:|||...|..::..:|..| .||    .||
  Fly    65 Y--GEIPELVHLSN----CFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGL----SAA 119

  Fly   125 RLFLENEQLASIAVAATSRNELMRRPEGSMALYLEPLNRDGSYRRVVERNNEDRSRRLSPDGRDR 189
            .|         :|:...|::.|....:  .|.||||  .....||:..||:....|      :.:
  Fly   120 EL---------VAIRHLSKHLLHNHID--HANYLEP--DTPPLRRIFTRNHMRHHR------QSQ 165

  Fly   190 LQALVRERYSRIARRSAARVGNMTSRPLLAPAPGDGSRLSGIQESIEAGQGIRNVIVEELSTSNY 254
            ||.....|...|:  .....|.::|.|.|. :..|....:...||:..|          ||:.. 
  Fly   166 LQTTPNSRIFDIS--VWLSTGRVSSDPQLL-SNNDPPEEAANSESLALG----------LSSGG- 216

  Fly   255 DPPFTINASASAILEQQQQQQV 276
              ||..:.....:|:...||:|
  Fly   217 --PFEHDDDRYVLLQWIAQQKV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15286NP_001285929.1 ZZ_PCMF_like 9..57 CDD:239078 16/47 (34%)
zf-Di19 78..>107 CDD:283297 8/28 (29%)
CG42585NP_001162977.1 ZZ_PCMF_like 6..54 CDD:239078 16/47 (34%)
zf-Di19 76..130 CDD:283297 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471862
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004459
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.