DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15286 and stmn3

DIOPT Version :9

Sequence 1:NP_001285929.1 Gene:CG15286 / 34834 FlyBaseID:FBgn0028531 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_001339376.4 Gene:stmn3 / 798970 ZFINID:ZDB-GENE-081124-2 Length:181 Species:Danio rerio


Alignment Length:115 Identity:27/115 - (23%)
Similarity:44/115 - (38%) Gaps:15/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 HPDASPLLVSTMVGLFEQQQAARLFLENEQLASIAVAATSRNELMRRPEGSMALYLEPLNRDGSY 167
            ||:.        .|.||..:...|   |::.:..|.....::.....||....|.|.|..::.|.
Zfish    30 HPNT--------FGQFEDMEVKSL---NKRASGQAFEVILKSPTDPSPERPQTLALPPQRKEPSL 83

  Fly   168 RRVVERNNEDRSRRLSPDGRDRLQALV--RERYSRIARRSAARVGNMTSR 215
            ..:..|.....:||.|.: :..|:.|.  |||...:..: |..|.|..|:
Zfish    84 GELQRRLEAAEARRRSQE-KQVLKQLAEKREREKEVLTK-AQEVNNNYSK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15286NP_001285929.1 ZZ_PCMF_like 9..57 CDD:239078
zf-Di19 78..>107 CDD:283297 2/3 (67%)
stmn3XP_001339376.4 Stathmin 43..175 CDD:279209 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.