DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15286 and KCMF1

DIOPT Version :9

Sequence 1:NP_001285929.1 Gene:CG15286 / 34834 FlyBaseID:FBgn0028531 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006712115.1 Gene:KCMF1 / 56888 HGNCID:20589 Length:389 Species:Homo sapiens


Alignment Length:490 Identity:108/490 - (22%)
Similarity:166/490 - (33%) Gaps:175/490 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MNRHERIECKGCGKRSLTFRCYRCLSCQDFDICEECYDNDFTTSTHPFDHPVVCVLIPADVELYF 67
            :...:.:.|..|.|.:...|.|:||.|.|:|:|..||::..||:.|..|||:.|:|...|.:||:
Human     9 LENDDGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYY 73

  Fly    68 GGEYISNYPPQSYRCPYCKRWGFNESTFLEHVSAMHPDASPLLVSTMVGLF--------EQQQAA 124
            |||..|...|||:.||||.:.|:.|::..|||::.|.:.|..::..:....        ....||
Human    74 GGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAA 138

  Fly   125 RLFLENEQLASIAVAATSRNELMRRPEGSMALYLEPLNRDGSYRRVVERNNEDRSRRLSPDGRDR 189
            .|.||:                 |.|        ..|:.....|.|         ||:...||  
Human   139 HLTLEH-----------------RAP--------RDLDESSGVRHV---------RRMFHPGR-- 167

  Fly   190 LQALVRERYSRIARRS-----AARVGNMTSRPLLAPAPGDGSRLSGIQESIEAGQGIRNVIVEEL 249
              .|...|    ||||     ::..|.::|.. .:.:|.:...:..|.|.:....|:|.....:|
Human   168 --GLGGPR----ARRSNMHFTSSSTGGLSSSQ-SSYSPSNREAMDPIAELLSQLSGVRRSAGGQL 225

  Fly   250 STSNYDPPFTINASASAILEQQQQQQVMGPSPNAAAPPIVTHPSLIEMMRFYDEAGLQPFPASSR 314
            ::|        ..|||.:.:.|.|.|                                       
Human   226 NSS--------GPSASQLQQLQMQLQ--------------------------------------- 243

  Fly   315 RVIRTRHANPA-QPAANIGNNTRSINVYGPTSAFTQASHNTRSLTAPDLFSLDERYRISRMPMFQ 378
              :..:||..| |......|.||..|....|:..||::..|.                       
Human   244 --LERQHAQAARQQLETARNATRRTNTSSVTTTITQSTATTN----------------------- 283

  Fly   379 ANPGALHRQGTGTRALDTRAVEFSEFPPEETELPLILGTSTIEDPSKLTKQRDQERRRFLCYRFT 443
                                               |..|    :.|:.|.|..|    ||..|..
Human   284 -----------------------------------IANT----ESSQQTLQNSQ----FLLTRLN 305

  Fly   444 TPRSSKRPQNHFLLQRAE---FVSQVLYSALCDED 475
            .|:.|:..:.....:||:   ||.::|.|.|..|:
Human   306 DPKMSETERQSMESERADRSLFVQELLLSTLVREE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15286NP_001285929.1 ZZ_PCMF_like 9..57 CDD:239078 19/47 (40%)
zf-Di19 78..>107 CDD:283297 12/28 (43%)
KCMF1XP_006712115.1 ZZ_PCMF_like 15..63 CDD:239078 19/47 (40%)
zf-Di19 84..145 CDD:283297 18/77 (23%)
Di19_C <288..336 CDD:291251 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6024
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004459
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.