DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15286 and RNF114

DIOPT Version :10

Sequence 1:NP_609706.2 Gene:CG15286 / 34834 FlyBaseID:FBgn0028531 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_061153.1 Gene:RNF114 / 55905 HGNCID:13094 Length:228 Species:Homo sapiens


Alignment Length:31 Identity:10/31 - (32%)
Similarity:16/31 - (51%) Gaps:1/31 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NYPPQ-SYRCPYCKRWGFNESTFLEHVSAMH 103
            |.|.: ::.||||....|::...:||....|
Human   134 NVPNRYTFPCPYCPEKNFDQEGLVEHCKLFH 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15286NP_609706.2 ZZ_PCMF_like 9..57 CDD:239078
zf-Di19 78..>107 CDD:428539 8/27 (30%)
PTZ00266 <119..>240 CDD:173502
RNF114NP_061153.1 RING-HC_RNF114 26..71 CDD:438202
zf_C2HC_14 85..117 CDD:465807
zf-Di19 140..200 CDD:428539 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.