powered by:
Protein Alignment CG15286 and stmn2a
DIOPT Version :9
Sequence 1: | NP_001285929.1 |
Gene: | CG15286 / 34834 |
FlyBaseID: | FBgn0028531 |
Length: | 511 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001005923.2 |
Gene: | stmn2a / 449651 |
ZFINID: | ZDB-GENE-041010-85 |
Length: | 180 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 16/68 - (23%) |
Similarity: | 33/68 - (48%) |
Gaps: | 11/68 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 LMRRPEGSMALYLEPLNRDGSYRRV--------VERNNEDRSRRLSPDGRDRLQALVRERYSRIA 202
|..:.|....:.|:.:..:.::.:: :|:|.|:|...|:. ..|||.. :||::.|.
Zfish 107 LAEKREHERDVLLKAMEENSNFSKMAEEKLILKMEQNKENREAHLAA-MIDRLHE--KERHAAIV 168
Fly 203 RRS 205
||:
Zfish 169 RRN 171
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1280 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.