DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15286 and stai

DIOPT Version :9

Sequence 1:NP_001285929.1 Gene:CG15286 / 34834 FlyBaseID:FBgn0028531 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster


Alignment Length:193 Identity:52/193 - (26%)
Similarity:85/193 - (44%) Gaps:23/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ECKGCGKRSLTF-RCYRCLSC-QDFDICEECYD--NDFTTSTHPFDHPVVCVLIPADVELYFGGE 70
            :|||||:....| |.|.|..| .:...|.:|:|  .:..|.||..|..:..:...:.::.:|.||
  Fly    11 KCKGCGQIRADFDRRYGCSECGSEVMYCGQCFDEGRNQHTETHKDDRRIKIIYHRSFLDKFFSGE 75

  Fly    71 YISN-YPPQSYRCPYCKRWGFNESTFLEHVSAMH---PDASPLLVSTMVGLFEQQQAARLFLENE 131
            .:.| ...:||.|.:||: .|:......|:|.||   .|||.|.|  |:....|:.     |||.
  Fly    76 KLLNGDASKSYNCVFCKK-RFSAEELQLHLSEMHSNPADASALTV--MLERMRQED-----LENR 132

  Fly   132 QLASIAVAATSRNEL-----MRRPEGSMALYLEPL--NRDGSYRRVVERNNEDRSRRLSPDGR 187
            ....|.....||..|     :..|..::|:...|:  .::.|...:.::......||:|.:.:
  Fly   133 IATEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTPGKNVSVEEIEQKLKAAEERRISLEAK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15286NP_001285929.1 ZZ_PCMF_like 9..57 CDD:239078 17/50 (34%)
zf-Di19 78..>107 CDD:283297 11/31 (35%)
staiNP_001245912.1 Stathmin 138..267 CDD:279209 10/58 (17%)
beta_CA <242..313 CDD:294276
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.