DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15286 and CG31835

DIOPT Version :9

Sequence 1:NP_001285929.1 Gene:CG15286 / 34834 FlyBaseID:FBgn0028531 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_723881.1 Gene:CG31835 / 318972 FlyBaseID:FBgn0051835 Length:349 Species:Drosophila melanogaster


Alignment Length:282 Identity:73/282 - (25%)
Similarity:111/282 - (39%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HERIECKGCGKRSLTFRCYRCLSCQDFDICEECYDNDFTTSTHPFDHPVVCV-----LIPADVEL 65
            |..|.|.||.........:|||.|.::::|:.|||:...|..|..:||:...     |:|.   |
  Fly     3 HRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLFPDSDDLVPL---L 64

  Fly    66 YFGGE-----YISNYPPQSYRCPYCKRWGFNESTFLEHVSAMHPDASPLLVSTM-VGLFEQQQAA 124
            |  ||     ::||    .:.||:|.........|:|||...|..::..:|..| .||    .||
  Fly    65 Y--GEIPELVHLSN----CFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGL----SAA 119

  Fly   125 RLFLENEQLASIAVAATSRNELMRRPEGSMALYLEPLNRDGSYRRVVERNNEDRSRRLSPDGRDR 189
            .|         :|:...|::.|....:  .|.||||  .....||:..||:....|      :.:
  Fly   120 EL---------VAIRHLSKHLLHNHID--HANYLEP--DTPPLRRIFTRNHMRHHR------QSQ 165

  Fly   190 LQALVRERYSRIARRSAARVGNMTSRPLLAPAPGDGSRLSGIQESIEAGQGIRNVIVEELSTSNY 254
            ||.....|...|:  .....|.::|.|.|. :..|....:...||:..|          ||:.. 
  Fly   166 LQTTPNSRIFDIS--VWLSTGRVSSDPQLL-SNNDPPEEAANSESLALG----------LSSGG- 216

  Fly   255 DPPFTINASASAILEQQQQQQV 276
              ||..:.....:|:...||:|
  Fly   217 --PFEHDDDRYVLLQWIAQQKV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15286NP_001285929.1 ZZ_PCMF_like 9..57 CDD:239078 16/47 (34%)
zf-Di19 78..>107 CDD:283297 8/28 (29%)
CG31835NP_723881.1 ZZ_PCMF_like 6..54 CDD:239078 16/47 (34%)
zf-Di19 76..130 CDD:283297 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6024
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004459
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.690

Return to query results.
Submit another query.