DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and PRPF4B

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_003904.3 Gene:PRPF4B / 8899 HGNCID:17346 Length:1007 Species:Homo sapiens


Alignment Length:472 Identity:139/472 - (29%)
Similarity:221/472 - (46%) Gaps:68/472 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NSNSNNNNNIGSPVSSSTTNSSNGGN------------ER------GSSTKSNSSSGSGSSGNSA 148
            :||.:..:...||.||:.|.|.:..:            ||      .:|.|:..:..:....|  
Human   558 DSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNN-- 620

  Fly   149 SSTGSGELKCNTPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLG 213
               ||.:.|...|...:|....|..|..........:.|:   |.::.:...|            
Human   621 ---GSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKD---FKENPNLRDN------------ 667

  Fly   214 YDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDH-KTNTHVAIKIIRNKKRFLNQAVVE 277
            :.|..|.|::...:.:..||.:....|:|.|..|:||.|: :.|..||:|||||.:......:.|
Human   668 WTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKE 732

  Fly   278 LNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYN-GFSMSLIRRFCN 341
            |..|.:|.:.|.|...:.:.:..:.|.::|||:.||.:|:||.|::||...: |..:..:|.:..
Human   733 LEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQ 797

  Fly   342 SIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYV-DRKIYTYIQSRFYRSPEVI 405
            .:...|:||.:.||:|.|:||:|||:.: ..:.:|:.||||:.:| |..|..|:.|||||:||:|
Human   798 QLFLALKLLKRCNILHADIKPDNILVNE-SKTILKLCDFGSASHVADNDITPYLVSRFYRAPEII 861

  Fly   406 LGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLF---- 466
            :|..|...|||||:||.|.|||||..||||:.....|...|::.|..|..:|    |:.:|    
Human   862 IGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMI----RKGVFKDQH 922

  Fly   467 FDSRDAPRCITNTKGRKR---------SPGSKSLAHILHCQD---------RYFIDFLQRCLEWD 513
            ||.......|...|..:|         :|....||.::.||.         ....|.|.:.|..|
Human   923 FDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLD 987

  Fly   514 PAERMTPDEAAHHEFLQ 530
            ||:|::.::|..|.|:|
Human   988 PAKRISINQALQHAFIQ 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 117/367 (32%)
S_TKc 233..529 CDD:214567 110/320 (34%)
PRPF4BNP_003904.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..533
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..583 8/23 (35%)
STKc_PRP4 686..1003 CDD:271037 111/321 (35%)
S_TKc 694..1003 CDD:214567 109/313 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.