DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and AT1G73450

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_177487.2 Gene:AT1G73450 / 843680 AraportID:AT1G73450 Length:1152 Species:Arabidopsis thaliana


Alignment Length:505 Identity:156/505 - (30%)
Similarity:240/505 - (47%) Gaps:84/505 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GSRRLDGHNNHV-------AANENTVT---TTSL------------------NGNGNGNGNSNSN 106
            ||.:.||...|.       :.|..|||   .|.|                  :.:.:...:...|
plant   678 GSSQKDGQLMHAESSKSLWSGNRETVTRDRNTELLSASTATDDMVATWRQKSSDSSSSRSSVKEN 742

  Fly   107 NNNNIGSPVSSSTTNSSNGGNERGSSTKSNSSSGSGSSGNSASSTGSGELKCNTPMTPSELVKKF 171
            |..:|.|..||.::.|:....||..:.|.|.|| ....|::.:      |.....:...|.|::.
plant   743 NATSIKSVNSSPSSLSNYARGERKHAEKENDSS-EREDGHATA------LDDEEAVAVQEQVRQI 800

  Fly   172 RNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEIL 236
            :....:.|..:||:...         ||           ..|::::. |:.::.:..||.||.:.
plant   801 KAQEEEFETFDLKIVHR---------KN-----------RTGFEEEK-NFNVVLNSVIAGRYHVT 844

  Fly   237 EVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDY 301
            |.:|..:|.:.|:|.|.:|...|.||||:|.|.|.:|::.|:.:|..:.:.|....::::.:.||
plant   845 EYLGSAAFSKAIQAHDLQTGMDVCIKIIKNNKDFFDQSLDEIKLLKYVNKHDPADKYHLLRLYDY 909

  Fly   302 TYFRKHLCITFELMSLNLYELIKKNNYNG----FSMSLIRRFCNSIVKCLRLLYKENIIHCDLKP 362
            .|:|:||.|..||:..||||..|.|..:|    |:|..::......::.|:.|:...:|||||||
plant   910 FYYREHLLIVCELLKANLYEFHKFNRESGGEVYFTMPRLQSITIQCLESLQFLHGLGLIHCDLKP 974

  Fly   363 ENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELY 427
            ||||:|......|||||.||||:....:.:|:|||.||:|||||||.|...||:||||||||||.
plant   975 ENILVKSYSRCEIKVIDLGSSCFETDHLCSYVQSRSYRAPEVILGLPYDKKIDVWSLGCILAELC 1039

  Fly   428 TGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGR---KRS---- 485
            ||..||..::....||.:|.::|.....:::..|....:|           ||.|   :|:    
plant  1040 TGNVLFQNDSPASLLARVMGIVGSFDNEMLTKGRDSHKYF-----------TKNRMLYERNQESN 1093

  Fly   486 ------PGSKSLAHILHCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEFL 529
                  |...||.|.|...|:.|.||:...||.:|.:|.:..||..|.:|
plant  1094 RLEYLIPKRTSLRHRLPMGDQGFTDFVAHLLEINPKKRPSAAEALKHPWL 1143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 124/359 (35%)
S_TKc 233..529 CDD:214567 117/312 (38%)
AT1G73450NP_177487.2 PKc_DYRK_like 841..1143 CDD:271035 117/312 (38%)
S_TKc 841..1143 CDD:214567 117/312 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D870358at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.