DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and FC1

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_001030853.1 Gene:FC1 / 824525 AraportID:AT3G53570 Length:467 Species:Arabidopsis thaliana


Alignment Length:418 Identity:133/418 - (31%)
Similarity:204/418 - (48%) Gaps:72/418 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 PMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIE 225
            |...|.||..|             ||..::|.|          .|...:.....||.:|:|..:.
plant    66 PEFASGLVPNF-------------VYPNMFYNG----------LPRQGSPPWRPDDKDGHYVFVV 107

  Fly   226 HDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDAD 290
            .|.:..||:||..:|:|:||||:...|:|....||||:||:..::...|::|:::|..|...|..
plant   108 GDTLTPRYQILSKMGEGTFGQVLECFDNKNKEVVAIKVIRSINKYREAAMIEIDVLQRLTRHDVG 172

  Fly   291 GSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENI 355
            || ..:.:.::..:|.|:||.||.:..:||:.::||:|..|.:.|:|.....:::.:..::...:
plant   173 GS-RCVQIRNWFDYRNHICIVFEKLGPSLYDFLRKNSYRSFPIDLVRELGRQLLESVAYMHDLRL 236

  Fly   356 IHCDLKPENILLKQR-------------------------GSSSIKVIDFGSSCYVDRKIYTYIQ 395
            ||.|||||||||...                         .||:||:|||||:.: :.:.:.||.
plant   237 IHTDLKPENILLVSSEYIKIPDYKFLSRPTKDGSYFKNLPKSSAIKLIDFGSTTF-EHQDHNYIV 300

  Fly   396 S-RFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLG-LPPKVLIS 458
            | |.||:||||||:.:....|:||:||||.||.:|..||.....:|.||.:..||| |||.:::.
plant   301 STRHYRAPEVILGVGWNYPCDLWSIGCILVELCSGEALFQTHENLEHLAMMERVLGPLPPHMVLR 365

  Fly   459 VARRRRLFF------------DSRDAPRCITNTKGRKRSPGSKSLAHILHCQDRYFIDFLQRCLE 511
            ..||...:|            .|||:.:.:...   .|.| :..:.|:.|.... .||.||..|.
plant   366 ADRRSEKYFRRGAKLDWPEGATSRDSLKAVWKL---PRLP-NLIMQHVDHSAGD-LIDLLQGLLR 425

  Fly   512 WDPAERMTPDEAAHHEFLQPSASSRHRS 539
            :||.||....||.:|.|.   ..||.:|
plant   426 YDPTERFKAREALNHPFF---TRSREQS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 123/381 (32%)
S_TKc 233..529 CDD:214567 113/334 (34%)
FC1NP_001030853.1 PKc_CLK 102..443 CDD:271036 116/347 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.